PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10029015m
Common NameCICLE_v10029015mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GATA
Protein Properties Length: 281aa    MW: 31523.5 Da    PI: 8.906
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10029015mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.76.8e-18213247135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C + +Tp+WR+gp g+ktLCnaCG++yr+ +l
  Ciclev10029015m 213 CMHCEVAETPQWREGPMGPKTLCNACGVRYRSGRL 247
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.5E-17207257IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.332207243IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-15208270No hitNo description
Gene3DG3DSA:3.30.50.103.5E-14211244IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.55E-13212259No hitNo description
PROSITE patternPS003440213238IPR000679Zinc finger, GATA-type
PfamPF003206.1E-16213247IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MNDDNWIFSH LDEFFDDVVD TLEDLEACNI GVDDWNANFE ALEPPPFGWT DFPVVPTSNH  60
ISCHRPQVKQ KPSSTDTSSS RSSYVCNKSN DGKYLLLSQT SSPISVLESG GSCSADKHVP  120
INPKLVFAVK RARSKRRRPA TLNPLFIYPF ISSTSSTSED YHPETASESG SEMNLTEKPV  180
RKKQKRKKNL TVLSGSRENK KLSFQQTDTP RKCMHCEVAE TPQWREGPMG PKTLCNACGV  240
RYRSGRLVPE YRPAASPTFV PSLHSNSHKR IMEMRNKGRL *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.107880.0flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424556.10.0hypothetical protein CICLE_v10029015mg
TrEMBLA0A067GD860.0A0A067GD86_CITSI; Uncharacterized protein
TrEMBLV4SL760.0V4SL76_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.25e-52GATA transcription factor 11